About us Plans & pricing Contact us
Monitored since April 2012
Last update in February 2017
Screenshot of askpattycertifiedfemalefriendly.com taken in December 2016
This page contains the limited information from our database. The overview covers randomly-selected time period. To unlock full reports upgrade now


Find other websites of the askpattycertifiedfemalefriendly.com owner even in case of private WHOIS data.
If the same Google Analytics or Google Adsense tag is placed on few websites, you can assume that the owner of these websites is the same.
This parameter provides the opportunity to check the connections between domains over time. See domains connected with the askpattycertifiedfemalefriendly.com in the past on the basis of footprints left in websites' HTML code. This parameter is built around unique data, such as IP Address, Google Analytics tag and Google AdSense tag.
Loading domain list, please wait...

IP Address

See how the IP address of askpattycertifiedfemalefriendly.com has changed over time.
This parameter shows changes of IP address to which askpattycertifiedfemalefriendly.com domain has been assigned. Timer4web also finds other domains that have been assigned to the same IP address.
First Check: July 2012
Last Check: December 2016
Numbers of changes:

Ip history chart

Loading chart, please wait...

Reverse IP Lookup (domains associated by IP)

Reverse IP (domains/subdomains)

Loading chart, please wait...

Reverse IP (domain list)

Loading domain list, please wait...


Check the redirections to and from the askpattycertifiedfemalefriendly.com domain over time.
Timer4web system checks whether the askpattycertifiedfemalefriendly.com domain redirects or used to redirect to a different domain and checks the type of that redirection (301,302). This parameter also allows you to verify the list of domains that redirect or used to redirect to askpattycertifiedfemalefriendly.com domain along with the type of redirection.
First Check: September 2012
Last Check: December 2016
Number of checks: 53
From domains:
From subdomains:
To domains:
To subdomains:

Redirections chart

Loading domain list, please wait...

Redirections (domains/subdomains)

Loading chart, please wait...

Reverse Google Analytics Lookup

Check websites associated with askpattycertifiedfemalefriendly.com by Google Analytics Tag over time.
If the same Google Analytics tag is placed on few websites, you can assume that the owner of these websites is the same.
The parameter tracks changes in various scripts used on a website askpattycertifiedfemalefriendly.com and builds the history of changes over time.
First Check: September 2012
Last Check: February 2017
Number of checks: 53

Google Analytics Tags

Loading Analytics tag list, please wait...

Reverse Google Analytics ( domains, subdomains)

Loading chart, please wait...

Domain List

Loading domain list, please wait...

Reverse Google Adsense Lookup

Check websites associated with askpattycertifiedfemalefriendly.com by Google Adsense Tag over time.
If the same Google Adsense tag is placed on few websites, you can assume that the owner of these websites is the same.
We regularly check advertisement codes found on askpattycertifiedfemalefriendly.com website and track changes therein over time. At the moment, we are analysing Google AdSense, which is also used by us to determine connections between domains.
First Check: September 2012
Last Check: February 2017
Number of checks: 53

Google Adsense Tags

Loading Adsense tag list, please wait...

Reverse Google Adsense ( domains, subdomains)

Loading chart, please wait...

Domain list

Loading domain list, please wait...


Check how askpattycertifiedfemalefriendly.com WHOIS information has been changing over time.
We collect domain WHOIS information for askpattycertifiedfemalefriendly.com.
First Check: December 2015
Last Check: December 2016
Number of checks: 2
Loading parameter data, please wait...

Reverse WHOIS

Loading chart, please wait...

Domain List

Loading domain list, please wait...

Frontend & Backend

Get various technical information about askpattycertifiedfemalefriendly.com gathered over time.
We analyse the HTTP header. We check changes in protocol versions, web servers, language, charset, etc. In addition, this parameter makes it possible to see how some elements of askpattycertifiedfemalefriendly.com website content, such as meta title, meta keywords or meta description, have changed over time.
First Check: November 2012
Last Check: January 2017
Number of checks: 56
Screenshots taken: 16
Last screenshot date: December 2016
Http Response code:
Web server:
Language: n/a
Meta title:
Meta description: n/a
Meta keywords: n/a
show all

Security Check

Check if the askpattycertifiedfemalefriendly.com was mark as not safe for browsing.
We monitor whether browsing of the askpattycertifiedfemalefriendly.com website was safe for users in terms of various threats, i.e. whether askpattycertifiedfemalefriendly.com website was not blacklisted by antivirus companies.
First Check: April 2012
Last Check: November 2016
Number of checks: 51
Loading parameter data, please wait...

Robots.txt file

Keep track of robots.txt content over time.
Robots.txt (or Robots Exclusion Standard) is a file prepared exclusively for search engine robots. It contains a set of instructions describing the way the contents of a given website is to be indexed by search engines in accordance with the recommendations of the website owner. The file may contain the URL address to the sitemap.
fully allowed
partially allowed
First Check: August 2013
Last Check: February 2017
Number of checks: 42
Web crawlers allowed:
Web crawlers partially allowed:
Web crawlers disallowed:
Loading parameter data, please wait...


See how askpattycertifiedfemalefriendly.com website has been promoted on different social websites.
First Check: September 2012
Last Check: December 2016
Number of checks: 50

Social Buzz

People Interest

Loading parameter data, please wait...

Google Page Rank

Check changes made in Google PageRank parameter over time.
PageRank is an algorithm developed by Google which helps search engines determine the importance of askpattycertifiedfemalefriendly.com on the basis of quantity and quality of links redirecting to the website from other websites. The maximum value of PageRank is 10.
First Check: July 2012
Last Check: February 2016
Number of checks: 18
We build history of website changes by gathering various information from dozens of independent resources. Our goal is to collect only relevant information and present it in a simple and transparent way. Every month we visit 57 654 679 websites and check 12 parameters in 3 different categories. more...
Do you need a different parameter to be recorded?
sugest it now